PDB entry 1l9n

View 1l9n on RCSB PDB site
Description: Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions change structure for activation
Class: Transferase
Keywords: Activation, Calcium binding, transglutaminase, X-ray structure, Transferase
Deposited on 2002-03-26, released 2002-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-glutamine glutamyltransferase E3
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08188 (0-691)
      • see remark 999 (249)
      • engineered (263)
      • see remark 999 (560)
      • see remark 999 (652)
    Domains in SCOPe 2.07: d1l9na1, d1l9na2, d1l9na3, d1l9na4
  • Chain 'B':
    Compound: Protein-glutamine glutamyltransferase E3
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08188 (0-691)
      • see remark 999 (249)
      • engineered (263)
      • see remark 999 (560)
      • see remark 999 (652)
    Domains in SCOPe 2.07: d1l9nb1, d1l9nb2, d1l9nb3, d1l9nb4
  • Heterogens: BGL, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l9nA (A:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpntpfaatssmgleteeqep
    siigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatm
    sldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildnptltlev
    lnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdi
    lpsrsgtkqlladfscnkfpaikamlsidvae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9nA (A:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpsiigklkvagmlavgkevn
    lvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatmsldpeeeaehpikisyaqy
    erylksdnmiritavckvpdesevvverdiildnptltlevlnearvrkpvnvqmlfsnp
    ldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdilpsrsgtkqlladfscnkf
    paikamlsidvae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l9nB (B:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpntpfaatssmgleteeqep
    siigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatm
    sldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildnptltlev
    lnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdi
    lpsrsgtkqlladfscnkfpaikamlsidvae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9nB (B:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpsiigklkvagmlavgkevn
    lvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatmsldpeeeaehpikisyaqy
    erylksdnmiritavckvpdesevvverdiildnptltlevlnearvrkpvnvqmlfsnp
    ldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdilpsrsgtkqlladfscnkf
    paikamlsidvae