PDB entry 1l9j

View 1l9j on RCSB PDB site
Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type I Co-Crystals
Deposited on 2002-03-24, released 2002-06-12
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-12, with a file datestamp of 2002-06-12.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.248
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9jC (C:)
    qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
    mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
    avrp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9jD (D:)
    qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
    mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
    avrp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9jH (H:)
    gnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilp
    hgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghg
    hnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgs
    trllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapk
    rksvva
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9jL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9jM (M:)
    fstllgwfgnaqlgpiylgslgvlslfsglmwfftigiwfwyqagwnpavflrdlfffsl
    eppapeyglsfaaplkegglwliasffmfvavwswwgrtylraqalgmgkhtawaflsai
    wlwmvlgfirpilmgswseavpygifshldwtnnfslvhgnlfynpfhglsiaflygsal
    lfamhgatilavsrfggereleqiadrgtaaeraalfwrwtmgfnatmegihrwaiwmav
    lvtltggigillsgtvvdnwyvwgqnh
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9jR (R:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9jS (S:)
    fstllgwfgnaqlgpiylgslgvlslfsglmwfftigiwfwyqagwnpavflrdlfffsl
    eppapeyglsfaaplkegglwliasffmfvavwswwgrtylraqalgmgkhtawaflsai
    wlwmvlgfirpilmgswseavpygifshldwtnnfslvhgnlfynpfhglsiaflygsal
    lfamhgatilavsrfggereleqiadrgtaaeraalfwrwtmgfnatmegihrwaiwmav
    lvtltggigillsgtvvdnwyvwgqnh
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9jT (T:)
    gnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilp
    hgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghg
    hnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgs
    trllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapk
    rksvva