PDB entry 1l9b

View 1l9b on RCSB PDB site
Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type II Co-Crystals
Class: photosynthesis
Keywords: bacterial photosynthesis, protein-protein interaction, electron transfer proteins, membrane proteins, protein complexes, PHOTOSYNTHESIS
Deposited on 2002-03-22, released 2002-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: cytochrome c-2
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l9bc_
  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l9bh1, d1l9bh2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l9bl_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l9bm_
  • Heterogens: FE2, CL, NA, BCL, BPH, U10, HEM, LDA, HTO, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9bC (C:)
    qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
    mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
    avrp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1l9bH (H:)
    mvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9bH (H:)
    gnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilp
    hgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghg
    hnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgs
    trllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapk
    rksvva
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9bL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1l9bM (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9bM (M:)
    fstllgwfgnaqlgpiylgslgvlslfsglmwfftigiwfwyqagwnpavflrdlfffsl
    eppapeyglsfaaplkegglwliasffmfvavwswwgrtylraqalgmgkhtawaflsai
    wlwmvlgfirpilmgswseavpygifshldwtnnfslvhgnlfynpfhglsiaflygsal
    lfamhgatilavsrfggereleqiadrgtaaeraalfwrwtmgfnatmegihrwaiwmav
    lvtltggigillsgtvvdnwyvwgqnh