PDB entry 1l95

View 1l95 on RCSB PDB site
Description: similar hydrophobic replacements of leu 99 and phe 153 within the core of t4 lysozyme have different structural and thermodynamic consequences
Deposited on 1992-01-21, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.164
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1l95__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l95_ (-)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittvrtgtwdayk