PDB entry 1l8t

View 1l8t on RCSB PDB site
Description: Crystal Structure Of 3',5"-Aminoglycoside Phosphotransferase Type IIIa ADP Kanamycin A Complex
Deposited on 2002-03-21, released 2002-06-19
The last revision prior to the SCOP 1.63 freeze date was dated 2002-06-19, with a file datestamp of 2002-06-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1l8ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l8tA (A:)
    akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
    dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
    fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
    eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
    fdllgikpdwekikyyilldelf