PDB entry 1l8p

View 1l8p on RCSB PDB site
Description:
Deposited on 2002-03-21, released 2002-04-03
The last revision prior to the SCOP 1.65 freeze date was dated 2002-08-07, with a file datestamp of 2002-08-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1l8pa1, d1l8pa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1l8pb1, d1l8pb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1l8pc1, d1l8pc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1l8pd1, d1l8pd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l8pA (A:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l8pB (B:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l8pC (C:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l8pD (D:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkl