PDB entry 1l8j

View 1l8j on RCSB PDB site
Description: crystal structure of the endothelial protein c receptor and bound phospholipid molecule
Deposited on 2002-03-20, released 2002-06-26
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-24, with a file datestamp of 2002-07-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1l8ja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l8jA (A:)
lqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqs
glqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfr
peralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhi