PDB entry 1l7y

View 1l7y on RCSB PDB site
Description: Solution NMR Structure of C. elegans Protein ZK652.3. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET WR41.
Class: structural genomics, unknown function
Keywords: C.elegans, unknown function, northeast structural genomics consortium, ZK652.3, ubiquitin fold, beta-grasp fold, NESG, STRUCTURAL GENOMICS, STRUCTURAL PROTEOMICS, HYPOTHETICAL, PSI, Protein Structure Initiative
Deposited on 2002-03-18, released 2002-08-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein zk652.3
  Species: Caenorhabditis elegans
  Gene: ZK652.3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P34661 (0-93)
  Domains in SCOP 1.73: d1l7ya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l7yA (A:)
  msggtaattagskvtfkitltsdpklpfkvlsvpestpftavlkfaaeefkvpaatsaii
  tndgvgvnpaqpagniflkhgselrliprdrvgh