PDB entry 1l7y

View 1l7y on RCSB PDB site
Description: solution nmr structure of c. elegans protein zk652.3. northeast structural genomics consortium target wr41.
Deposited on 2002-03-18, released 2002-08-14
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1l7ya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l7yA (A:)
  msggtaattagskvtfkitltsdpklpfkvlsvpestpftavlkfaaeefkvpaatsaii
  tndgvgvnpaqpagniflkhgselrliprdrvgh