PDB entry 1l7i

View 1l7i on RCSB PDB site
Description:
Deposited on 2002-03-15, released 2002-07-10
The last revision prior to the SCOP 1.65 freeze date was dated 2002-07-10, with a file datestamp of 2002-07-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1l7ih1, d1l7ih2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1l7il1, d1l7il2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l7iH (H:)
    evqlvesggglvqpggslrlscaasgftftdytmdwvrqapgkglewvadvnpnsggsiy
    nqrfkgrftlsvdrskntlylqmnslraedtavyycarnlgpsfyfdywgqgtlvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l7iL (L:)
    diqmtqspsslsasvgdrvtitckasqdvsigvawyqqkpgkapklliysasyrytgvps
    rfsgsgsgtdftltisslqpedfatyycqqyyiypytfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec