PDB entry 1l6x
View 1l6x on RCSB PDB site
Description: fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c
Class: immune system
Keywords: IgG1 fc, protein A, fc complex, b-domain, IMMUNE SYSTEM
Deposited on
2002-03-14, released
2002-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.206
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: immunoglobulin gamma-1 heavy chain constant region
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1l6xa1, d1l6xa2 - Chain 'B':
Compound: Minimized B-domain of Protein A Z34C
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1l6xb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1l6xA (A:)
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
wqqgnvfscsvmhealhnhytqkslsl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1l6xB (B:)
fnmqcqrrfyealhdpnlneeqrnakiksirddc