PDB entry 1l6x

View 1l6x on RCSB PDB site
Description: fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c
Class: immune system
Keywords: IgG1 fc, protein A, fc complex, b-domain
Deposited on 2002-03-14, released 2002-04-10
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.206
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin gamma-1 heavy chain constant region
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • GB AAC82527 (0-206)
    Domains in SCOP 1.75: d1l6xa1, d1l6xa2
  • Chain 'B':
    Compound: Minimized B-domain of Protein A Z34C
    Species: synthetic, synthetic
    Domains in SCOP 1.75: d1l6xb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6xA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6xB (B:)
    fnmqcqrrfyealhdpnlneeqrnakiksirddc