PDB entry 1l6v

View 1l6v on RCSB PDB site
Description: structure of reduced bovine adrenodoxin
Deposited on 2002-03-14, released 2002-06-26
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-26, with a file datestamp of 2002-06-26.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1l6va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6vA (A:)
    dkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhif
    ekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvpda