PDB entry 1l6o
View 1l6o on RCSB PDB site
Description: xenopus dishevelled pdz domain
Class: gene regulation
Keywords: dishevelled, Wnt pathway, PDZ, molecular recognition, GENE REGULATION
Deposited on
2002-03-11, released
2003-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.279
AEROSPACI score: 0.26
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Segment polarity protein dishevelled homolog DVL-2
Species: Xenopus laevis [TaxId:8355]
Database cross-references and differences (RAF-indexed):
- Uniprot P51142 (1-89)
- see remark 999 (0)
- modified residue (8)
- modified residue (36)
- modified residue (52)
- modified residue (64)
- expression tag (90-94)
Domains in SCOPe 2.07: d1l6oa1, d1l6oa2 - Chain 'B':
Compound: Segment polarity protein dishevelled homolog DVL-2
Species: Xenopus laevis [TaxId:8355]
Database cross-references and differences (RAF-indexed):
- Uniprot P51142 (1-89)
- see remark 999 (0)
- modified residue (8)
- modified residue (36)
- modified residue (52)
- modified residue (64)
- expression tag (90-92)
Domains in SCOPe 2.07: d1l6ob1, d1l6ob2 - Chain 'C':
Compound: Segment polarity protein dishevelled homolog DVL-2
Species: Xenopus laevis [TaxId:8355]
Database cross-references and differences (RAF-indexed):
- Uniprot P51142 (1-89)
- see remark 999 (0)
- modified residue (8)
- modified residue (36)
- modified residue (52)
- modified residue (64)
- expression tag (90-91)
Domains in SCOPe 2.07: d1l6oc1, d1l6oc2 - Chain 'D':
Compound: Dapper 1
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Dapper 1
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Dapper 1
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1l6oA (A:)
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvaklehhh
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1l6oB (B:)
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvaklehhh
Sequence, based on observed residues (ATOM records): (download)
>1l6oB (B:)
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvakleh
- Chain 'C':
Sequence, based on SEQRES records: (download)
>1l6oC (C:)
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvaklehhh
Sequence, based on observed residues (ATOM records): (download)
>1l6oC (C:)
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvakle
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.