PDB entry 1l6g

View 1l6g on RCSB PDB site
Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-D-alanine
Class: isomerase
Keywords: alanine racemase, reaction mechanism, N-(5'-phosphopyridoxyl)-alanine
Deposited on 2002-03-10, released 2002-06-05
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alanine racemase
    Species: Bacillus stearothermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10724
      • modified residue (128)
    Domains in SCOP 1.75: d1l6ga1, d1l6ga2
  • Chain 'B':
    Compound: alanine racemase
    Species: Bacillus stearothermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10724
      • modified residue (128)
    Domains in SCOP 1.75: d1l6gb1, d1l6gb2
  • Heterogens: PDD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l6gA (A:)
    mndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagas
    rlavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysg
    pfpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsy
    qytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyp
    lkeafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvd
    gqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpcti
    syrvpriffrhkrimevrnaigrgessa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6gA (A:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnaigr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l6gB (B:)
    mndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagas
    rlavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysg
    pfpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsy
    qytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyp
    lkeafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvd
    gqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpcti
    syrvpriffrhkrimevrnaigrgessa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l6gB (B:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnaigr