PDB entry 1l6g

View 1l6g on RCSB PDB site
Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-D-alanine
Deposited on 2002-03-10, released 2002-06-05
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-05, with a file datestamp of 2002-06-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6gA (A:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnaigr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l6gB (B:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnaigr