PDB entry 1l64

View 1l64 on RCSB PDB site
Description: tolerance of t4 lysozyme to multiple xaa (right arrow) ala substitutions: a polyalanine alpha-helix containing ten consecutive alanines
Deposited on 1991-09-23, released 1991-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1l64__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l64_ (-)
    mnifemlrideglrlkiykdtegyytigighlltkspslaaaaaaaaaaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk