PDB entry 1l58

View 1l58 on RCSB PDB site
Description: analysis of the interaction between charged side chains and the alpha-helix dipole using designed thermostable mutants of phage t4 lysozyme
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1991-05-06, released 1991-10-15
The last revision prior to the SCOP 1.75 freeze date was dated 1991-10-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.167
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: t4 lysozyme
  Species: Bacteriophage T4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00720 (0-163)
    • conflict (142)
  Domains in SCOP 1.75: d1l58a_
• Heterogens: BME, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l58A (A:)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtanrakrvittfrtgtwdayknl