PDB entry 1l41

View 1l41 on RCSB PDB site
Description: contributions of engineered surface salt bridges to the stability of t4 lysozyme determined by directed mutagenesis
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1991-01-28, released 1991-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t4 lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • conflict (53)
      • conflict (82)
      • conflict (96)
      • conflict (111)
    Domains in SCOPe 2.08: d1l41a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l41A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnahlkpvydsldavrraalinmvfqmgetgvdgftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl