PDB entry 1l3y

View 1l3y on RCSB PDB site
Description: integrin egf-like module 3 from the beta-2 subunit
Class: Cell Adhesion
Keywords: integrin, beta-2 subunit, cell adhesion, cysteine-rich module, EGF-like module
Deposited on 2002-03-03, released 2002-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Integrin beta-2:CYSTEINE-RICH MODULE 3
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05107 (0-39)
    • cloning artifact (40)
  Domains in SCOPe 2.05: d1l3ya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l3yA (A:)
  ecdtinceryngqvcggpgrglcfcgkcrchpgfegsacqa