PDB entry 1l3y

View 1l3y on RCSB PDB site
Description: integrin egf-like module 3 from the beta-2 subunit
Deposited on 2002-03-03, released 2002-04-01
The last revision prior to the SCOP 1.71 freeze date was dated 2002-04-01, with a file datestamp of 2002-04-01.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1l3ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l3yA (A:)
    ecdtinceryngqvcggpgrglcfcgkcrchpgfegsacqa