PDB entry 1l3n

View 1l3n on RCSB PDB site
Description: The Solution Structure of Reduced Dimeric Copper Zinc SOD: the Structural Effects of Dimerization
Class: oxidoreductase
Keywords: reduced human copper/zinc superoxide dismutase, solution structure, NMR, homodimeric protein., OXIDOREDUCTASE
Deposited on 2002-02-28, released 2002-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (110)
    Domains in SCOPe 2.07: d1l3na_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (110)
    Domains in SCOPe 2.07: d1l3nb_
  • Heterogens: CU1, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l3nA (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l3nB (B:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq