PDB entry 1l37

View 1l37 on RCSB PDB site
Description: contributions of engineered surface salt bridges to the stability of t4 lysozyme determined by directed mutagenesis
Deposited on 1991-01-28, released 1991-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.85 Å
R-factor: 0.151
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1l37__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l37_ (-)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagfenslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl