PDB entry 1l36

View 1l36 on RCSB PDB site
Description: toward a simplification of the protein folding problem: a stabilizing polyalanine alpha-helix engineered in t4 lysozyme
Deposited on 1990-12-26, released 1991-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1994-04-30, with a file datestamp of 1994-05-17.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.164
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1l36__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l36_ (-)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
  lqqkrwdaaaaalaksrwynqtpnrakrvittfrtgtwdayk