PDB entry 1l2n

View 1l2n on RCSB PDB site
Description: Smt3 Solution Structure
Class: protein binding
Keywords: Smt3, Ubiquitin-like Protein, NMR, Structure, PROTEIN BINDING
Deposited on 2002-02-22, released 2002-03-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein SMT3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1l2na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l2nA (A:)
    msdsevnqeakpevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkem
    dslrflydgiriqadqtpedldmedndiieahreqiggaty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2nA (A:)
    ethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtped
    ldmedndiieahreqi