PDB entry 1l2i

View 1l2i on RCSB PDB site
Description: Human Estrogen Receptor alpha Ligand-binding Domain in Complex with (R,R)-5,11-cis-diethyl-5,6,11,12-tetrahydrochrysene-2,8-diol and a Glucocorticoid Receptor Interacting Protein 1 NR box II Peptide
Class: transcription receptor/coactivator
Keywords: nuclear receptor, transcription factor, estrogen, agonist, coactivator
Deposited on 2002-02-21, released 2002-05-01
The last revision prior to the SCOP 1.75 freeze date was dated 2002-05-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.203
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • modified residue (123)
    Domains in SCOP 1.75: d1l2ia_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • modified residue (123)
    Domains in SCOP 1.75: d1l2ib_
  • Chain 'C':
    Compound: glucocorticoid receptor-interacting protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: glucocorticoid receptor-interacting protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, ETC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l2iA (A:)
    mdpmikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladre
    lvhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrn
    qgkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekd
    hihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknv
    vplydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2iA (A:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvyleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l2iB (B:)
    mdpmikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladre
    lvhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrn
    qgkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekd
    hihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknv
    vplydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2iB (B:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytkdhihrvldkitdtlihlmakagl
    tlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldah
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.