PDB entry 1l2f

View 1l2f on RCSB PDB site
Description: Crystal structure of NusA from Thermotoga maritima: a structure-based role of the N-terminal domain
Deposited on 2002-02-20, released 2003-09-23
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l2fA (A:)
    mgsshhhhhhnynipttenlyfqghmnigllealdqleeekgiskeevipilekalvsay
    rknfgnsknvevvidrntgnikvyqllevveevedpatqisleeakkidplaevgsivkk
    elnvknfgriaaqtakqvliqrirelekekqfekyselkgtvttaevirvmgewadirig
    kletrlpkkewipgeeikagdlvkvyiidvvkttkgpkilvsrrvpefviglmkleipev
    engiveikaiarepgvrtkvavasndpnvdpigacigeggsriaailkelkgekldvlkw
    sddpkqlianalapatvieveildkenkaarvlvpptqlslaigkggqnarlaakltgwk
    idikpimnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2fA (A:)
    mnigllealdqleeekgiskeevipilekalvsayrknfgnsknvevvidrntgnikvyq
    llevveevedpatqisleeakkidplaevgsivkkelnvknfgriaaqtakqvliqrire
    lekekqfekyselkgtvttaevirvmgewadirigkletrlpkkewipgeeikagdlvkv
    yiidvvkttkgpkilvsrrvpefviglmkleipevengiveikaiarepgvrtkvavasn
    dpnvdpigacigeggsriaailkelkgekldvlkwsddpkqlianalapatvieveildk
    enkaarvlvpptqlslaigkggqnarlaakltgwkidikpimnl