PDB entry 1l1p

View 1l1p on RCSB PDB site
Description: Solution Structure of the PPIase Domain from E. coli Trigger Factor
Class: isomerase
Keywords: mixed beta-alpha structure, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics, ISOMERASE
Deposited on 2002-02-19, released 2003-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trigger Factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A850 (4-105)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d1l1pa1, d1l1pa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l1pA (A:)
    gshmqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgqgrmipgfedgik
    ghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpelt