PDB entry 1l1i

View 1l1i on RCSB PDB site
Description: Solution Structure of the Tenebrio molitor Antifreeze Protein
Class: Antifreeze protein
Keywords: beta-helix, Antifreeze protein
Deposited on 2002-02-16, released 2002-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thermal hysteresis protein isoform YL-1 (2-14)
  Species: Tenebrio molitor [TaxId:7067]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O16119 (0-83)
  Domains in SCOPe 2.07: d1l1ia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l1iA (A:)
  qctggadctsctgactgcgncpnavtctnsqhcvkantctgstdcntaqtctnskdcfea
  ntctdstncykatactnssgcpgh