PDB entry 1l1f

View 1l1f on RCSB PDB site
Description: Structure of human glutamate dehydrogenase-apo form
Class: oxidoreductase
Keywords: Allostery, negative cooperativity, OXIDOREDUCTASE
Deposited on 2002-02-15, released 2002-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.262
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate Dehydrogenase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l1fa1, d1l1fa2
  • Chain 'B':
    Compound: Glutamate Dehydrogenase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l1fb1, d1l1fb2
  • Chain 'C':
    Compound: Glutamate Dehydrogenase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l1fc1, d1l1fc2
  • Chain 'D':
    Compound: Glutamate Dehydrogenase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l1fd1, d1l1fd2
  • Chain 'E':
    Compound: Glutamate Dehydrogenase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l1fe1, d1l1fe2
  • Chain 'F':
    Compound: Glutamate Dehydrogenase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l1ff1, d1l1ff2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l1fA (A:)
    seavadreddpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfgdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpea
    dkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqes
    lerkfgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgld
    lrtaayvnaiekvfkvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1fA (A:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l1fB (B:)
    seavadreddpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfgdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpea
    dkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqes
    lerkfgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgld
    lrtaayvnaiekvfkvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1fB (B:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l1fC (C:)
    seavadreddpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfgdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpea
    dkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqes
    lerkfgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgld
    lrtaayvnaiekvfkvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1fC (C:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1l1fD (D:)
    seavadreddpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfgdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpea
    dkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqes
    lerkfgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgld
    lrtaayvnaiekvfkvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1fD (D:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1l1fE (E:)
    seavadreddpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfgdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpea
    dkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqes
    lerkfgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgld
    lrtaayvnaiekvfkvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1fE (E:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1l1fF (F:)
    seavadreddpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfgdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpea
    dkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqes
    lerkfgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgld
    lrtaayvnaiekvfkvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1fF (F:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft