PDB entry 1l1f

View 1l1f on RCSB PDB site
Description: Structure of human glutamate dehydrogenase-apo form
Deposited on 2002-02-15, released 2002-03-06
The last revision prior to the SCOP 1.67 freeze date was dated 2002-05-15, with a file datestamp of 2002-05-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.262
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l1fA (A:)
    seavadreddpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfgdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpea
    dkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqes
    lerkfgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgld
    lrtaayvnaiekvfkvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1fA (A:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l1fB (B:)
    seavadreddpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfgdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpea
    dkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqes
    lerkfgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgld
    lrtaayvnaiekvfkvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1fB (B:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l1fC (C:)
    seavadreddpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfgdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpea
    dkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqes
    lerkfgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgld
    lrtaayvnaiekvfkvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1fC (C:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1l1fD (D:)
    seavadreddpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfgdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpea
    dkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqes
    lerkfgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgld
    lrtaayvnaiekvfkvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1fD (D:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1l1fE (E:)
    seavadreddpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfgdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpea
    dkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqes
    lerkfgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgld
    lrtaayvnaiekvfkvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1fE (E:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1l1fF (F:)
    seavadreddpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfgdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpea
    dkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqes
    lerkfgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgld
    lrtaayvnaiekvfkvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1fF (F:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft