PDB entry 1l1e

View 1l1e on RCSB PDB site
Description: Crystal Structure of Mycolic Acid Cyclopropane Synthase PcaA Complexed with S-adenosyl-L-homocysteine
Class: transferase
Keywords: METHYLTRANSFERASE, S-ADENOSYL-L-HOMOCYSTEINE COFACTOR, ALPHA/BETA, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2002-02-15, released 2002-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.222
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mycolic acid synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: pcaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l1ea_
  • Chain 'B':
    Compound: mycolic acid synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: pcaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l1eb_
  • Heterogens: CO3, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l1eA (A:)
    msvqltphfgnvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgkl
    nlepgmtlldigcgwgatmrraiekydvnvvgltlsenqaghvqkmfdqmdtprsrrvll
    egwekfdepvdrivsigafehfghqryhhffevthrtlpadgkmllhtivrptfkegrek
    gltlthelvhftkfilaeifpggwlpsiptvheyaekvgfrvtavqslqlhyartldmwa
    taleankdqaiaiqsqtvydrymkyltgcaklfrqgytdvdqftlek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1eA (A:)
    ydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklnlepgmtlldigcgw
    gatmrraiekydvnvvgltlsenqaghvqkmfdqmdtprsrrvllegwekfdepvdrivs
    igafehfghqryhhffevthrtlpadgkmllhtivrptfkegrekgltlthelvhftkfi
    laeifpggwlpsiptvheyaekvgfrvtavqslqlhyartldmwataleankdqaiaiqs
    qtvydrymkyltgcaklfrqgytdvdqftlek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l1eB (B:)
    msvqltphfgnvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgkl
    nlepgmtlldigcgwgatmrraiekydvnvvgltlsenqaghvqkmfdqmdtprsrrvll
    egwekfdepvdrivsigafehfghqryhhffevthrtlpadgkmllhtivrptfkegrek
    gltlthelvhftkfilaeifpggwlpsiptvheyaekvgfrvtavqslqlhyartldmwa
    taleankdqaiaiqsqtvydrymkyltgcaklfrqgytdvdqftlek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1eB (B:)
    ydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklnlepgmtlldigcgw
    gatmrraiekydvnvvgltlsenqaghvqkmfdqmdtprsrrvllegwekfdepvdrivs
    igafehfghqryhhffevthrtlpadgkmllhtivrptfklvhftkfilaeifpggwlps
    iptvheyaekvgfrvtavqslqlhyartldmwataleankdqaiaiqsqtvydrymkylt
    gcaklfrqgytdvdqftlek