PDB entry 1l17

View 1l17 on RCSB PDB site
Description: hydrophobic stabilization in t4 lysozyme determined directly by multiple substitutions of ile 3
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1989-05-01, released 1990-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: t4 lysozyme
  Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00720 (0-163)
    • conflict (2)
  Domains in SCOPe 2.08: d1l17a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l17A (A:)
  mnvfemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl