PDB entry 1l16

View 1l16 on RCSB PDB site
Description: structural analysis of the temperature-sensitive mutant of bacteriophage t4 lysozyme, glycine 156 (right arrow) aspartic acid
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1988-02-05, released 1988-04-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: t4 lysozyme
  Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00720 (0-163)
    • conflict (155)
  Domains in SCOPe 2.08: d1l16a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l16A (A:)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtdtwdayknl