PDB entry 1l0x

View 1l0x on RCSB PDB site
Description:
Deposited on 2002-02-14, released 2002-04-03
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-03, with a file datestamp of 2002-04-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.232
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1l0xa1, d1l0xa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1l0xb1, d1l0xb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1l0xc1, d1l0xc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1l0xd1, d1l0xd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0xA (A:)
    avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvledlrqvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0xB (B:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldsntsqievylttk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0xC (C:)
    avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvledlrqvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0xD (D:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldsntsqievylttk