PDB entry 1l0v

View 1l0v on RCSB PDB site
Description: Quinol-Fumarate Reductase with Menaquinol Molecules
Deposited on 2002-02-13, released 2002-03-13
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-28, with a file datestamp of 2002-08-28.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.245
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vA (A:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vB (B:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vC (C:)
    ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
    dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
    ivilfvalyw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vD (D:)
    minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
    sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vM (M:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppa
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vN (N:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vO (O:)
    ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
    dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
    ivilfvalyw
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vP (P:)
    minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
    sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti