PDB entry 1l0n

View 1l0n on RCSB PDB site
Description: native structure of bovine mitochondrial cytochrome bc1 complex
Class: oxidoreductase
Keywords: cytochrome bc1, membrane protein, heme protein, iron sulfur protein, cytochrome b, cytochrome c1, mitochondrial processing protease, mpp, OXIDOREDUCTASE
Deposited on 2002-02-11, released 2003-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.261
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquinol-cytochrome c reductase complex core protein I
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l0na1, d1l0na2
  • Chain 'B':
    Compound: ubiquinol-cytochrome c reductase complex core protein 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l0nb1, d1l0nb2
  • Chain 'C':
    Compound: cytochrome b
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l0nc1, d1l0nc2
  • Chain 'D':
    Compound: cytochrome c1, heme protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l0nd1, d1l0nd2
  • Chain 'E':
    Compound: ubiquinol-cytochrome c reductase iron-sulfur subunit
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l0ne1, d1l0ne2
  • Chain 'F':
    Compound: Ubiquinol-cytochrome c reductase complex 14 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l0nf_
  • Chain 'G':
    Compound: ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l0ng_
  • Chain 'H':
    Compound: Ubiquinol-cytochrome c reductase complex 11 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l0nh_
  • Chain 'I':
    Compound: ubiquinol-cytochrome c reductase 8 kda protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l0ni_
  • Chain 'J':
    Compound: Ubiquinol-cytochrome c reductase complex 7.2 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l0nj_
  • Chain 'K':
    Compound: cytochrome b-c1 complex 6.4K protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07552 (0-End)
      • conflict (46)
    Domains in SCOPe 2.06: d1l0nk_
  • Heterogens: HEM, FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0nA (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l0nB (B:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0nB (B:)
    vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
    tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
    vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
    nhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvhaa
    lvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasy
    sdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvesse
    gfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfi
    del
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l0nC (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0nC (C:)
    nirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttta
    fssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilllt
    vmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafh
    filpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmll
    vlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsilila
    lipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyflli
    lvlmptagtienkllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0nD (D:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0nE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1l0nF (F:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0nF (F:)
    vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
    ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1l0nG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0nG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1l0nH (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0nH (H:)
    eeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhc
    vahklfnslk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1l0nI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0nI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1l0nJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0nJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1l0nK (K:)
    mltrflgpryrqlarnwvptaqlwgavgavglvsatdsrlildwvptingkfkkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0nK (K:)
    mltrflgpryrqlarnwvptaqlwgavgavglvsatdsrlildwvptin