PDB entry 1l0m

View 1l0m on RCSB PDB site
Description: Solution structure of Bacteriorhodopsin
Deposited on 2002-02-11, released 2002-03-27
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-27, with a file datestamp of 2002-03-27.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1l0ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0mA (A:)
    rpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygl
    tmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvga
    ltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsayp
    vvwligsegagivplnietllfmvldvsakvg