PDB entry 1kz7

View 1kz7 on RCSB PDB site
Description: Crystal Structure of the DH/PH Fragment of Murine Dbs in Complex with the Placental Isoform of Human Cdc42
Class: signaling protein
Keywords: guanine nucleotide exchange factor (GEF), small G-protein, SIGNALING PROTEIN
Deposited on 2002-02-06, released 2002-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine nucleotide exchange factor dbs
    Species: Mus musculus [TaxId:10090]
    Gene: Dbs
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64096
      • modified residue (15)
      • modified residue (40)
      • modified residue (45)
      • modified residue (64)
      • see remark 999 (74-79)
      • modified residue (97)
      • modified residue (160)
      • modified residue (191)
      • modified residue (211)
      • modified residue (237)
      • modified residue (275)
      • see remark 999 (318)
    Domains in SCOPe 2.07: d1kz7a1, d1kz7a2
  • Chain 'B':
    Compound: cdc42 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953
      • engineered (187)
    Domains in SCOPe 2.07: d1kz7b_
  • Chain 'C':
    Compound: guanine nucleotide exchange factor dbs
    Species: Mus musculus [TaxId:10090]
    Gene: Dbs
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64096
      • modified residue (15)
      • modified residue (40)
      • modified residue (45)
      • modified residue (64)
      • see remark 999 (74-79)
      • modified residue (97)
      • modified residue (160)
      • modified residue (191)
      • modified residue (211)
      • modified residue (237)
      • modified residue (275)
      • see remark 999 (318)
    Domains in SCOPe 2.07: d1kz7c1, d1kz7c2
  • Chain 'D':
    Compound: cdc42 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kz7d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kz7A (A:)
    mgeeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkkni
    lfgnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrq
    csdcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealss
    ilgilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqr
    hlflhekavlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynare
    evyiiqaptpeikaawvnairkvltsqlqacreasqhraleqshslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kz7A (A:)
    eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
    gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
    dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
    gilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkgelarfkpmqrhlflhek
    avlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqa
    ptpeikaawvnairkvltsqlqacreasqhraleqsh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kz7B (B:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kz7C (C:)
    mgeeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkkni
    lfgnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrq
    csdcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealss
    ilgilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqr
    hlflhekavlfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynare
    evyiiqaptpeikaawvnairkvltsqlqacreasqhraleqshslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kz7C (C:)
    eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
    gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
    dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
    gilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkelarfkpmqrhlflhekav
    lfckkreengegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqapt
    peikaawvnairkvltsqlqacreasqhra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kz7D (D:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kz7D (D:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal