PDB entry 1kxi

View 1kxi on RCSB PDB site
Description: structure of cytotoxin homolog precursor
Class: cytotoxin
Keywords: venom, cytotoxin, cardiotoxin, multigene family, signal
Deposited on 1996-08-29, released 1997-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.207
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cardiotoxin v
  Species: Naja atra [TaxId:8656]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62375 (0-61)
  Domains in SCOPe 2.06: d1kxia_
• Chain 'B':
  Compound: cardiotoxin v
  Species: Naja atra [TaxId:8656]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62375 (0-61)
  Domains in SCOPe 2.06: d1kxib_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kxiA (A:)
  lkchntqlpfiyktcpegknlcfkatlkkfplkfpvkrgcadncpknsallkyvccstdk
  cn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kxiB (B:)
  lkchntqlpfiyktcpegknlcfkatlkkfplkfpvkrgcadncpknsallkyvccstdk
  cn