PDB entry 1kxc

View 1kxc on RCSB PDB site
Description: sindbis virus capsid (n190k mutant), tetragonal crystal form
Deposited on 1996-05-05, released 1996-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.177
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1kxc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxc_ (-)
    alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
    aqlpvnmrseaftytsehpegfykwhhgavqysggrftiprgvggrgdsgrpimdnsgrv
    vaivlggadegtrtalsvvtwnskgktikttpegteew