PDB entry 1kx9

View 1kx9 on RCSB PDB site
Description: antennal chemosensory protein a6 from the moth mamestra brassicae
Deposited on 2002-01-31, released 2002-12-04
The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-04, with a file datestamp of 2002-12-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.204
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1kx9a_
  • Chain 'B':
    Domains in SCOP 1.65: d1kx9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kx9A (A:)
    edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
    nqekgayrviehlikneieiwreltakydptgnwrkkyedrakaagivipee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx9A (A:)
    ytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkctenqe
    kgayrviehlikneieiwreltakydptgnwrkkyedrakaagivipe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kx9B (B:)
    edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
    nqekgayrviehlikneieiwreltakydptgnwrkkyedrakaagivipee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx9B (B:)
    inldeilankrllvayvncvmergkcspegkelkehlqdaiengckkctenqekgayrvi
    ehlikneieiwreltakydptgnwrkkyedrakaagivipee