PDB entry 1kx8

View 1kx8 on RCSB PDB site
Description: Antennal Chemosensory Protein A6 from Mamestra brassicae, tetragonal form
Deposited on 2002-01-31, released 2002-12-04
The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-04, with a file datestamp of 2002-12-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.265
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1kx8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kx8A (A:)
    edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
    nqekgayrviehlikneieiwreltakydptgnwrkkyedrakaagivipee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kx8A (A:)
    ninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkctenqekgayrv
    iehlikneieiwreltakydptgnwrkkyedrakaagivi