PDB entry 1kwp

View 1kwp on RCSB PDB site
Description: Crystal Structure of MAPKAP2
Class: transferase
Keywords: MAPKAP2, protein kinase, signal transduction, TRANSFERASE
Deposited on 2002-01-30, released 2002-09-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.233
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP Kinase Activated Protein Kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kwpa_
  • Chain 'B':
    Compound: MAP Kinase Activated Protein Kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kwpb_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kwpA (A:)
    mlsnsqgqsppvpfpapapppqpptpalphppaqppppppqqfpqfhvksglqikknaii
    ddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwrasqcphivri
    vdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeaiqylhsi
    niahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapevlgpeky
    dkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkm
    lirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsal
    atmrvdyeqikikkiedasnplllkrrkkaraleaaalah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kwpA (A:)
    fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
    elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafterease
    imksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsgpekydksc
    dmwslgvimyillcgyppfysnhglaispgmktrirmyefpnpewsevseevkmlirnll
    kteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmrvd
    yeqikikkiedasnplllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kwpB (B:)
    mlsnsqgqsppvpfpapapppqpptpalphppaqppppppqqfpqfhvksglqikknaii
    ddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwrasqcphivri
    vdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeaiqylhsi
    niahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapevlgpeky
    dkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkm
    lirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsal
    atmrvdyeqikikkiedasnplllkrrkkaraleaaalah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kwpB (B:)
    pqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarr
    evelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafterea
    seimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettsgpekydk
    scdmwslgvimyillcgyppfysnhglaispgmktrirmgqynpewsevseevkmlirnl
    lkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmrv
    dyeqikikkieda