PDB entry 1kvx

View 1kvx on RCSB PDB site
Description: carboxylic ester hydrolase, single mutant d99a of bovine pancreatic pla2, 1.9 a orthorhombic form
Class: hydrolase
Keywords: hydrolase, enzyme, carboxylic ester hydrolase
Deposited on 1998-04-28, released 1998-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bos taurus [TaxId:9913]
    Gene: MATURE PLA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00593 (0-122)
      • engineered (98)
    Domains in SCOPe 2.08: d1kvxa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kvxA (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqakklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncarnaaicfskvpynkehknldk
    knc