PDB entry 1kvl

View 1kvl on RCSB PDB site
Description: X-ray Crystal Structure of AmpC S64G Mutant beta-Lactamase in Complex with Substrate and Product Forms of Cephalothin
Class: hydrolase
Keywords: amide hydrolase, beta-lactamase, cephalothin, substrate-enzyme complex, product-enzyme complex
Deposited on 2002-01-27, released 2002-03-13
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.195
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli
    Gene: K12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00811 (0-357)
      • engineered (60)
    Domains in SCOP 1.75: d1kvla_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli
    Gene: K12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00811 (0-357)
      • engineered (60)
    Domains in SCOP 1.75: d1kvlb_
  • Heterogens: PO4, KCP, CLS, THN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kvlA (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    gvsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kvlB (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    gvsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq