PDB entry 1kv6

View 1kv6 on RCSB PDB site
Description: X-ray structure of the orphan nuclear receptor ERR3 ligand-binding domain in the constitutively active conformation
Deposited on 2002-01-25, released 2003-01-25
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-25, with a file datestamp of 2003-01-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1kv6a_
  • Chain 'B':
    Domains in SCOP 1.63: d1kv6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kv6A (A:)
    nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
    adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
    kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
    gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemlea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kv6B (B:)
    nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
    adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
    kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
    gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemlea