PDB entry 1kuq

View 1kuq on RCSB PDB site
Description: crystal structure of t3c mutant s15 ribosomal protein in complex with 16s rrna
Deposited on 2002-01-22, released 2003-06-24
The last revision prior to the SCOP 1.69 freeze date was dated 2003-06-24, with a file datestamp of 2003-06-24.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: 0.231
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1kuqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kuqA (A:)
    mpickeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmv
    gqrrrllrylqredperyralieklgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kuqA (A:)
    ckeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvgqr
    rrllrylqredperyralieklgi