PDB entry 1kum

View 1kum on RCSB PDB site
Description: glucoamylase, granular starch-binding domain, nmr, minimized average structure
Class: hydrolase
Keywords: hydrolase, starch binding domain
Deposited on 1996-01-12, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucoamylase
    Species: Aspergillus niger [TaxId:5061]
    Gene: A. NIGER GLAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kuma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kumA (A:)
    cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
    lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr