PDB entry 1kul

View 1kul on RCSB PDB site
Description: glucoamylase, granular starch-binding domain, nmr, 5 structures
Class: hydrolase
Keywords: hydrolase, starch binding domain
Deposited on 1996-01-12, released 1996-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 1996-07-11, with a file datestamp of 2007-06-04.
Experiment type: NMR5
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucoamylase
    Species: ASPERGILLUS NIGER
    Gene: A. NIGER GLAA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kula_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kulA (A:)
    cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
    lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr